Q96KD3 has 344 amino acids
Query: GARIL_Rab2_bd [M=71]
Accession: PF12480.12
Description: Golgi associated RAB2 interactor protein-like, Rab2B-binding domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.7e-31 92.9 1.1 1.3e-30 91.8 1.1 1.6 1 Q96KD3
Domain annotation for each sequence (and alignments):
>> Q96KD3
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 91.8 1.1 1.3e-30 1.3e-30 2 71 .] 141 208 .. 140 208 .. 0.98
Alignments for each domain:
== domain 1 score: 91.8 bits; conditional E-value: 1.3e-30
GARIL_Rab2_bd 2 leltrllPlkfvklsvydkekqllklklvtgRsfyleLtksadepeslfqmwlrlvhlLrsplsttekdq 71
+ l+r+lPl fv+l+v+d+ +++l+l++vt++++yl+L++ d+pe++f++w+rlv++L+++ls+t+kd+
Q96KD3 141 IFLKRILPLRFVELQVCDHYQRILQLRTVTEKIYYLKLHP--DHPETVFHFWIRLVQILQKGLSITTKDP 208
689*************************************..**************************96 PP
Or compare Q96KD3 to CDD or PaperBLAST