SwissProt::B2RXB0 has 297 amino acids
Query: GARIL_Rab2_bd [M=71]
Accession: PF12480.12
Description: Golgi associated RAB2 interactor protein-like, Rab2B-binding domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.3e-31 92.3 1.1 1.4e-30 91.6 1.1 1.4 1 SwissProt::B2RXB0
Domain annotation for each sequence (and alignments):
>> SwissProt::B2RXB0
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 91.6 1.1 1.4e-30 1.4e-30 2 71 .] 108 175 .. 107 175 .. 0.98
Alignments for each domain:
== domain 1 score: 91.6 bits; conditional E-value: 1.4e-30
GARIL_Rab2_bd 2 leltrllPlkfvklsvydkekqllklklvtgRsfyleLtksadepeslfqmwlrlvhlLrsplsttekdq 71
++l+r+lPlk+v+l++yd+++++l++++vt++++yl+L++ ++p+ +fq+w+rlv++L+++ls+t+kd+
SwissProt::B2RXB0 108 ITLSRILPLKYVELQIYDRTQRILRVRTVTEKIYYLRLHE--KHPQAVFQFWIRLVKILQKGLSITTKDP 175
68**************************************..**************************96 PP
Or compare SwissProt::B2RXB0 to CDD or PaperBLAST