SwissProt::Q3UZD7 has 341 amino acids
Query: GARIL_Rab2_bd [M=71]
Accession: PF12480.12
Description: Golgi associated RAB2 interactor protein-like, Rab2B-binding domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.9e-30 89.4 0.8 1.6e-29 88.3 0.8 1.6 1 SwissProt::Q3UZD7
Domain annotation for each sequence (and alignments):
>> SwissProt::Q3UZD7
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 88.3 0.8 1.6e-29 1.6e-29 2 71 .] 141 208 .. 140 208 .. 0.97
Alignments for each domain:
== domain 1 score: 88.3 bits; conditional E-value: 1.6e-29
GARIL_Rab2_bd 2 leltrllPlkfvklsvydkekqllklklvtgRsfyleLtksadepeslfqmwlrlvhlLrsplsttekdq 71
+ l+ +lPlkfv+l++ d ++++l+l++vt++++yl+L++ d+pe++f++w+rlv++L+++ls+t+kd+
SwissProt::Q3UZD7 141 INLKSILPLKFVELQIWDDQERVLRLRTVTEKIYYLKLHP--DHPETVFHFWIRLVQILHKGLSITTKDP 208
6799************************************..**************************96 PP
Or compare SwissProt::Q3UZD7 to CDD or PaperBLAST