SwissProt::Q5STT6 has 665 amino acids
Query: GARIL_Rab2_bd [M=71]
Accession: PF12480.12
Description: Golgi associated RAB2 interactor protein-like, Rab2B-binding domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.4e-33 100.5 0.3 4.1e-33 99.7 0.3 1.3 1 SwissProt::Q5STT6
Domain annotation for each sequence (and alignments):
>> SwissProt::Q5STT6
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 99.7 0.3 4.1e-33 4.1e-33 1 65 [. 123 187 .. 123 192 .. 0.98
Alignments for each domain:
== domain 1 score: 99.7 bits; conditional E-value: 4.1e-33
GARIL_Rab2_bd 1 tleltrllPlkfvklsvydkekqllklklvtgRsfyleLtksadepeslfqmwlrlvhlLrspls 65
tleltrllPlkfvk+sv+d+ekq+l+lkl+tgR+fyl+L++s+d++e+lf +w++lv+lLr+p++
SwissProt::Q5STT6 123 TLELTRLLPLKFVKISVHDHEKQQLRLKLATGRTFYLQLCPSSDAREDLFCYWEKLVYLLRPPMT 187
79*************************************************************96 PP
Or compare SwissProt::Q5STT6 to CDD or PaperBLAST