XP_011534805.1 has 422 amino acids
Query: GARIL_Rab2_bd [M=71]
Accession: PF12480.12
Description: Golgi associated RAB2 interactor protein-like, Rab2B-binding domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.5e-28 83.9 0.5 7.4e-28 82.9 0.5 1.6 1 XP_011534805.1
Domain annotation for each sequence (and alignments):
>> XP_011534805.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 82.9 0.5 7.4e-28 7.4e-28 2 70 .. 116 184 .. 115 185 .. 0.97
Alignments for each domain:
== domain 1 score: 82.9 bits; conditional E-value: 7.4e-28
GARIL_Rab2_bd 2 leltrllPlkfvklsvydkekqllklklvtgRsfyleLtksadepeslfqmwlrlvhlLrsplsttekd 70
l+ltr+lPl+fv+lsv+d e++ lk+klv+gR++yl+L+ sa ++++lf++w+ l+ lL+++ + +k+
XP_011534805.1 116 LVLTRFLPLQFVTLSVHDAENMSLKVKLVSGRAYYLQLCTSAYKQDTLFSQWVALISLLNQEKAKVSKV 184
89************************************************************9999997 PP
Or compare XP_011534805.1 to CDD or PaperBLAST