XP_030111331.1 has 310 amino acids
Query: GARIL_Rab2_bd [M=71]
Accession: PF12480.12
Description: Golgi associated RAB2 interactor protein-like, Rab2B-binding domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-29 88.7 1.8 1.3e-29 88.5 0.8 1.6 2 XP_030111331.1
Domain annotation for each sequence (and alignments):
>> XP_030111331.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 88.5 0.8 1.3e-29 1.3e-29 2 71 .] 109 176 .. 108 176 .. 0.97
2 ? -3.3 0.0 0.6 0.6 47 65 .. 203 221 .. 196 224 .. 0.63
Alignments for each domain:
== domain 1 score: 88.5 bits; conditional E-value: 1.3e-29
GARIL_Rab2_bd 2 leltrllPlkfvklsvydkekqllklklvtgRsfyleLtksadepeslfqmwlrlvhlLrsplsttekdq 71
+ l+ +lPlkfv+l++ d ++++l+l++vt++++yl+L++ d+pe++f++w+rlv++L+++ls+t+kd+
XP_030111331.1 109 INLKSILPLKFVELQIWDDQERVLRLRTVTEKIYYLKLHP--DHPETVFHFWIRLVQILHKGLSITTKDP 176
6799************************************..**************************96 PP
== domain 2 score: -3.3 bits; conditional E-value: 0.6
GARIL_Rab2_bd 47 eslfqmwlrlvhlLrspls 65
+ q + l hl+ ++ s
XP_030111331.1 203 SKGLQPSESLTHLMAQGES 221
4445667778888877655 PP
Or compare XP_030111331.1 to CDD or PaperBLAST