NP_001108406.1 has 121 amino acids
Query: Cox20 [M=101]
Accession: PF12597.12
Description: Cytochrome c oxidase assembly protein COX20
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-18 53.1 0.0 1.6e-18 52.7 0.0 1.2 1 NP_001108406.1
Domain annotation for each sequence (and alignments):
>> NP_001108406.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 52.7 0.0 1.6e-18 1.6e-18 18 92 .. 25 99 .. 16 106 .. 0.92
Alignments for each domain:
== domain 1 score: 52.7 bits; conditional E-value: 1.6e-18
Cox20 18 klvkiPCaRdalltGigagfvvGslrfllgkniakaaNwavgtfvlgsivsyeqCqlkRrkekekmkravevvee 92
++ kiPC+R+++l+Gig+g+++G f+ +++ a +vgtf l+ ++ + +C+++ ++++ ++ ++++++
NP_001108406.1 25 DISKIPCFRESFLYGIGTGIGFGLAAFVKTSKPMLAQHIGVGTFSLSTLLYWSYCRYRWSQQRFDAQLLQDALKD 99
6789******************************************************99999888877776665 PP
Or compare NP_001108406.1 to CDD or PaperBLAST