VIMSS148446 has 56 amino acids
Query: DUF3950 [M=30]
Accession: PF13132.10
Description: Domain of unknown function (DUF3950)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.4e-26 77.7 3.3 3.3e-26 77.3 3.3 1.2 1 VIMSS148446
Domain annotation for each sequence (and alignments):
>> VIMSS148446
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 77.3 3.3 3.3e-26 3.3e-26 1 30 [] 21 50 .. 21 50 .. 1.00
Alignments for each domain:
== domain 1 score: 77.3 bits; conditional E-value: 3.3e-26
DUF3950 1 mleQIeiaLekektsNFSAWVkEACRekLc 30
mleQIe+aL++ekt+NFSAWVkEACRekLc
VIMSS148446 21 MLEQIEFALKSEKTRNFSAWVKEACREKLC 50
9***************************** PP
Or compare VIMSS148446 to CDD or PaperBLAST