VIMSS10108524 has 801 amino acids
Query: ARC6-like_IMS [M=117] Accession: PF13355.10 Description: ARC6-like, IMS domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-35 106.3 0.0 1.4e-34 105.3 0.0 1.6 1 VIMSS10108524 Domain annotation for each sequence (and alignments): >> VIMSS10108524 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 105.3 0.0 1.4e-34 1.4e-34 1 117 [] 679 794 .. 679 794 .. 0.99 Alignments for each domain: == domain 1 score: 105.3 bits; conditional E-value: 1.4e-34 ARC6-like_IMS 1 AeeliqkWlsaKaealgpehdiesleeiltgpllsqwrkraaqlkkngsyweyklkslsvesvevsskgpdratveatveEsaqlyengqlkenrs 96 Ae+++ kW+++K+ a+gp+h+ie l+e+l+g +l+ w++raa++++ g ++y+l +lsv+sv+vs++g +ra veat+eEsa l + ++++n++ VIMSS10108524 679 AENIVSKWQKIKSLAFGPDHRIEMLPEVLDGRMLKIWTDRAAETAQLGLVYDYTLLKLSVDSVTVSADG-TRALVEATLEESACLSDLVHPENNAT 773 89****************************************************************988.9************************* PP ARC6-like_IMS 97 ydstlrvrYelvrengkWkIq 117 + +t+++rYe+ +++++WkI+ VIMSS10108524 774 DVRTYTTRYEVFWSKSGWKIT 794 *******************96 PP
Or compare VIMSS10108524 to CDD or PaperBLAST