VIMSS165060 has 798 amino acids
Query: ARC6-like_IMS [M=117] Accession: PF13355.10 Description: ARC6-like, IMS domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-40 124.0 1.4 6.8e-40 122.5 1.4 1.9 1 VIMSS165060 Domain annotation for each sequence (and alignments): >> VIMSS165060 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 122.5 1.4 6.8e-40 6.8e-40 1 117 [] 678 791 .. 678 791 .. 0.98 Alignments for each domain: == domain 1 score: 122.5 bits; conditional E-value: 6.8e-40 ARC6-like_IMS 1 AeeliqkWlsaKaealgpehdiesleeiltgpllsqwrkraaqlkkngsyweyklkslsvesvevsskgpdratveatveEsaqlyengqlkenrs 96 A+++i++Wl +Ka+alg eh+iesl+eiltg++lsqwr a q+k++++++ey++ s++v+s+++s+ +p+ra+v atv+E +q+yengq +s VIMSS165060 678 ARKIIENWLATKASALGAEHKIESLNEILTGSALSQWRLIALQDKADNRHREYSH-SVKVDSISKSDIDPNRASVGATVRELTQFYENGQKG--KS 770 789****************************************************.*********************************888..78 PP ARC6-like_IMS 97 ydstlrvrYelvrengkWkIq 117 +d++lrvrYel+r+++ W+Iq VIMSS165060 771 SDERLRVRYELIRQDDIWRIQ 791 8*******************7 PP
Or compare VIMSS165060 to CDD or PaperBLAST