biolip::5gtbA has 130 amino acids
Query: ARC6-like_IMS [M=117] Accession: PF13355.10 Description: ARC6-like, IMS domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-36 111.3 0.0 2.3e-36 111.2 0.0 1.0 1 biolip::5gtbA Domain annotation for each sequence (and alignments): >> biolip::5gtbA # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 111.2 0.0 2.3e-36 2.3e-36 1 117 [] 8 123 .. 8 123 .. 0.99 Alignments for each domain: == domain 1 score: 111.2 bits; conditional E-value: 2.3e-36 ARC6-like_IMS 1 AeeliqkWlsaKaealgpehdiesleeiltgpllsqwrkraaqlkkngsyweyklkslsvesvevsskgpdratveatveEsaqlyengqlkenrs 96 Ae+++ kW+++K+ a+gp+h+ie l+e+l+g +l+ w++raa++++ g ++y+l +lsv+sv+vs++g +ra veat+eEsa l + ++++n++ biolip::5gtbA 8 AENIVSKWQKIKSLAFGPDHRIEMLPEVLDGRMLKIWTDRAAETAQLGLVYDYTLLKLSVDSVTVSADG-TRALVEATLEESACLSDLVHPENNAT 102 89****************************************************************988.9************************* PP ARC6-like_IMS 97 ydstlrvrYelvrengkWkIq 117 + +t+++rYe+ +++++WkI+ biolip::5gtbA 103 DVRTYTTRYEVFWSKSGWKIT 123 *******************96 PP
Or compare biolip::5gtbA to CDD or PaperBLAST