WP_000067268.1 has 260 amino acids
Query: AadA_C [M=103]
Accession: PF13427.10
Description: Aminoglycoside adenylyltransferase, C-terminal domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.6e-39 119.4 0.0 5.3e-39 118.8 0.0 1.3 1 WP_000067268.1
Domain annotation for each sequence (and alignments):
>> WP_000067268.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 118.8 0.0 5.3e-39 5.3e-39 2 102 .. 153 253 .. 152 254 .. 0.98
Alignments for each domain:
== domain 1 score: 118.8 bits; conditional E-value: 5.3e-39
AadA_C 2 vldpvpredlvdailadveelleeieederyvvLtLaRvlatletgeilsKdeAaewalerlPeeyrpllaeArkaylgeeeekweedeeeveef 96
+l vp +d+++ai+++++el+e+i++der+v+LtLaR+++t++tgei+sKd Aaewa++ lP+e+ ll+ Ark y+ge ++kwe+ ++v+++
WP_000067268.1 153 ILVSVPLTDIRRAIKDSLPELIEGIKGDERNVILTLARMWQTVTTGEITSKDVAAEWAIPLLPKEHVTLLDIARKGYRGECDDKWEGLYSKVKAL 247
7899******************************************************************************************* PP
AadA_C 97 akymla 102
+kym++
WP_000067268.1 248 VKYMKN 253
****97 PP
Or compare WP_000067268.1 to CDD or PaperBLAST