PaperBLAST – Find papers about a protein or its homologs

 

Align WP_009314825.1 to PF13503 (DUF4123)

WP_009314825.1 has 282 amino acids

Query:       DUF4123  [M=123]
Accession:   PF13503.10
Description: Domain of unknown function (DUF4123)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.3e-26   79.4   3.0    1.3e-26   79.4   3.0    2.0  2  WP_009314825.1  


Domain annotation for each sequence (and alignments):
>> WP_009314825.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   79.4   3.0   1.3e-26   1.3e-26       1     122 [.      18     138 ..      18     139 .. 0.86
   2 ?   -1.0   0.4       0.1       0.1      70      70 ..     229     229 ..     170     274 .. 0.63

  Alignments for each domain:
  == domain 1  score: 79.4 bits;  conditional E-value: 1.3e-26
         DUF4123   1 lYaLlDg.aadpellelleaesgeaaseLyagtpeeelaevgPwLveledasel..sallrleeegwgpslglllaSaa..pleelarhLrsllq 90 
                     lY++lD+  + +e  +lle  ++++  +Ly gtp+++la++gP+L++l++ + +  +    ++    ++++g+ laS+   +le larh+r +l 
  WP_009314825.1  18 LYLVLDSdGQLDERDALLEGREPHQYGNLYSGTPASSLAAIGPYLFRLDALDHPviQ----ALLKSPERHWGW-LASSVssDLESLARHWRTRLV 107
                     7******888888888888888866555**********************9777654....356999******.66655468999*********5 PP

         DUF4123  91 vrlpdgeavllRfydprvlrallptldeeqrs 122
                        +  +++l Rf+d+rvl + l++l +eqr 
  WP_009314825.1 108 TG-ERPNQALYRFHDSRVLGRALAHLQPEQRP 138
                     55.6**************************95 PP

  == domain 2  score: -1.0 bits;  conditional E-value: 0.1
         DUF4123  70 l 70 
                     +
  WP_009314825.1 229 W 229
                     1 PP



Or compare WP_009314825.1 to CDD or PaperBLAST