WP_009314825.1 has 282 amino acids
Query: DUF4123 [M=123] Accession: PF13503.10 Description: Domain of unknown function (DUF4123) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-26 79.4 3.0 1.3e-26 79.4 3.0 2.0 2 WP_009314825.1 Domain annotation for each sequence (and alignments): >> WP_009314825.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 79.4 3.0 1.3e-26 1.3e-26 1 122 [. 18 138 .. 18 139 .. 0.86 2 ? -1.0 0.4 0.1 0.1 70 70 .. 229 229 .. 170 274 .. 0.63 Alignments for each domain: == domain 1 score: 79.4 bits; conditional E-value: 1.3e-26 DUF4123 1 lYaLlDg.aadpellelleaesgeaaseLyagtpeeelaevgPwLveledasel..sallrleeegwgpslglllaSaa..pleelarhLrsllq 90 lY++lD+ + +e +lle ++++ +Ly gtp+++la++gP+L++l++ + + + ++ ++++g+ laS+ +le larh+r +l WP_009314825.1 18 LYLVLDSdGQLDERDALLEGREPHQYGNLYSGTPASSLAAIGPYLFRLDALDHPviQ----ALLKSPERHWGW-LASSVssDLESLARHWRTRLV 107 7******888888888888888866555**********************9777654....356999******.66655468999*********5 PP DUF4123 91 vrlpdgeavllRfydprvlrallptldeeqrs 122 + +++l Rf+d+rvl + l++l +eqr WP_009314825.1 108 TG-ERPNQALYRFHDSRVLGRALAHLQPEQRP 138 55.6**************************95 PP == domain 2 score: -1.0 bits; conditional E-value: 0.1 DUF4123 70 l 70 + WP_009314825.1 229 W 229 1 PP
Or compare WP_009314825.1 to CDD or PaperBLAST