PaperBLAST – Find papers about a protein or its homologs

 

Align E7F8X0 to PF13778 (DUF4174)

E7F8X0 has 460 amino acids

Query:       DUF4174  [M=120]
Accession:   PF13778.9
Description: Domain of unknown function (DUF4174)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    3.2e-36  110.7   0.0    4.8e-36  110.1   0.0    1.3  1  E7F8X0    


Domain annotation for each sequence (and alignments):
>> E7F8X0  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  110.1   0.0   4.8e-36   4.8e-36       2     120 .]     330     448 ..     329     448 .. 0.98

  Alignments for each domain:
  == domain 1  score: 110.1 bits;  conditional E-value: 4.8e-36
  DUF4174   2 LasfkwkrRlLiisapseedkllkkqrkeleaqecelaeRdllvlelvgseaketgkieeeqlsseliseLrkelkisekdfsmvLigkdggvkeryeapvs 103
              L++f++krRlL++s+p++ +++++ q+ +l+++ c+l+ R+++v+el+gs ++ +g+i+e++l++e i++Lr+ l+is  +f+mvL++  g ++er+ +p++
   E7F8X0 330 LDQFYEKRRLLVVSTPDNGNQKYRLQNMMLQKAGCGLDLRHVTVIELLGSPPRAVGRIKEQRLQPEVIEDLRQALHISMAYFTMVLLDDYGVDRERFVNPTN 431
              99**************************************************************************************************** PP

  DUF4174 104 lealfdlIDampmRqqE 120
               e+lf+++D++ + ++E
   E7F8X0 432 SEELFSYVDEFLLTEEE 448
              ***********988776 PP



Or compare E7F8X0 to CDD or PaperBLAST