PaperBLAST – Find papers about a protein or its homologs

 

Align Q63769 to PF13778 (DUF4174)

Q63769 has 464 amino acids

Query:       DUF4174  [M=120]
Accession:   PF13778.9
Description: Domain of unknown function (DUF4174)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    2.2e-37  114.5   0.0    2.9e-37  114.1   0.0    1.2  1  Q63769    


Domain annotation for each sequence (and alignments):
>> Q63769  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  114.1   0.0   2.9e-37   2.9e-37       2     120 .]     333     451 ..     332     451 .. 0.99

  Alignments for each domain:
  == domain 1  score: 114.1 bits;  conditional E-value: 2.9e-37
  DUF4174   2 LasfkwkrRlLiisapseedkllkkqrkeleaqecelaeRdllvlelvgseaketgkieeeqlsseliseLrkelkisekdfsmvLigkdggvkeryeapvs 103
              L++f++krRlLi+s+p++ + l++ q+ +l++++c+l+ R+++v+elvg  ++ +g+i+ + ++++l+ +Lr  l+i+  +fsmvL++k+g++kery + v+
   Q63769 333 LDQFYEKRRLLIVSTPTARNLLYRLQLGMLQQAQCGLDLRHITVVELVGVFPTLIGRIRAKIMPPALALQLRLLLRIPLYSFSMVLVDKHGMDKERYVSLVT 434
              99***************************************************************************9999********************* PP

  DUF4174 104 lealfdlIDampmRqqE 120
              + alf+lID++p+R++E
   Q63769 435 PMALFNLIDTFPLRKEE 451
              ***************98 PP



Or compare Q63769 to CDD or PaperBLAST