B4E220 has 329 amino acids
Query: MINDY-3_4_CD [M=344]
Accession: PF13898.10
Description: Deubiquitinating enzyme MINDY-3/4, conserved domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.3e-40 123.4 0.0 7.2e-40 123.0 0.0 1.1 1 B4E220
Domain annotation for each sequence (and alignments):
>> B4E220
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 123.0 0.0 7.2e-40 7.2e-40 245 334 .. 2 88 .. 1 93 [. 0.96
Alignments for each domain:
== domain 1 score: 123.0 bits; conditional E-value: 7.2e-40
MINDY-3_4_CD 245 lqvGsrLKtPklPiWvvcseshysVlFstnrellsdwkaerrfdLyYydglasqqeeirltvdtrakkeeakekseeklipplellirTK 334
+qvG+ LKtP++PiWvvcsesh+s+lFs++ ll+dw++er fdLyYydgla+qqe+irlt+dt+++ +e+++++l+pplel+irT
B4E220 2 CQVGCFLKTPRFPIWVVCSESHFSILFSLQPGLLRDWRTERLFDLYYYDGLANQQEQIRLTIDTTQT---ISEDTDNDLVPPLELCIRTN 88
8****************************************************************99...8899***************6 PP
Or compare B4E220 to CDD or PaperBLAST