VIMSS341380 has 87 amino acids
Query: DUF4212 [M=79]
Accession: PF13937.10
Description: Domain of unknown function (DUF4212)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.9e-39 119.3 6.5 4.3e-39 119.1 6.5 1.0 1 VIMSS341380
Domain annotation for each sequence (and alignments):
>> VIMSS341380
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 119.1 6.5 4.3e-39 4.3e-39 1 79 [] 9 86 .. 9 86 .. 0.98
Alignments for each domain:
== domain 1 score: 119.1 bits; conditional E-value: 4.3e-39
DUF4212 1 akaYwranlrlililLviWflvsfglgilfaeelntirtflgfplgFwfaaqgsilvfvvlifvYalrmnrlDrkygve 79
akaYw +n++l+++l+viWf+vsfg+gilf++ ln+++ ++g++lgFwfa+qgsi++f+ +if+Ya+rm+++Dr++gv+
VIMSS341380 9 AKAYWDKNVKLMIGLMVIWFVVSFGCGILFVDVLNQFQ-LGGYKLGFWFAQQGSIYAFLGIIFYYAWRMRQIDREFGVD 86
589**********************************6.**************************************96 PP
Or compare VIMSS341380 to CDD or PaperBLAST