VIMSS75709 has 55 amino acids
Query: DUF4223 [M=54] Accession: PF13978.10 Description: Protein of unknown function (DUF4223) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-42 129.2 1.0 2.2e-42 129.1 1.0 1.0 1 VIMSS75709 Domain annotation for each sequence (and alignments): >> VIMSS75709 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 129.1 1.0 2.2e-42 2.2e-42 1 54 [] 1 54 [. 1 54 [. 0.99 Alignments for each domain: == domain 1 score: 129.1 bits; conditional E-value: 2.2e-42 DUF4223 1 mkklvkvavvaavlatLtaCtGhienkkknCsYDYLlhPaisiskiiGGCGPia 54 m+k++kva+v+avlatLtaCtGhien++knCsYDYLlhPaisiskiiGGCGP+a VIMSS75709 1 MNKFIKVALVGAVLATLTACTGHIENRDKNCSYDYLLHPAISISKIIGGCGPTA 54 9***************************************************97 PP
Or compare VIMSS75709 to CDD or PaperBLAST