E9Q309 has 3095 amino acids
Query: DUF4378 [M=166] Accession: PF14309.10 Description: Domain of unknown function (DUF4378) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.4e-11 28.5 1.5 3.5e-10 26.6 0.1 2.9 2 E9Q309 Domain annotation for each sequence (and alignments): >> E9Q309 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.0 0.1 0.89 0.89 88 119 .. 950 980 .. 943 996 .. 0.59 2 ! 26.6 0.1 3.5e-10 3.5e-10 54 165 .. 2944 3076 .. 2916 3077 .. 0.81 Alignments for each domain: == domain 1 score: -4.0 bits; conditional E-value: 0.89 DUF4378 88 kvssassrrrpkklsgeelleevwseirswls 119 ++ +ss+++++ +s+e+ + ++s i+s+ + E9Q309 950 RQTDSSSSDIQA-CSQERAKRSLCSSIDSVSE 980 333333444444.7899999999999998443 PP == domain 2 score: 26.6 bits; conditional E-value: 3.5e-10 DUF4378 54 resrserklLFDlvneiLveilel.f....krsfsyppskvssassrrrpkklsgeelleevwseir.................swlspe.....selvl 126 +++r ++ +FDl ei +ei++ +++k ++ +s+ ++ +++ + l+e+ i +w ++ + + E9Q309 2944 TSRRVYKQAVFDLTKEIFEEIFAEdPnvnqP-----VWMKPCRINSSYFRR-VKNPNNLDEIKHFITtevlkllslkkepnhktDWQKMMkfgrkKRDRV 3037 5789999**************9975555533.....444444444444443.5666677777777777777888799999999966666679999999** PP DUF4378 127 delvdkdlssregkwldledeveeigleierlIledLve 165 d+++ ++l ++e +w++++++ ++ +++++ I+e+L++ E9Q309 3038 DHILVQELHEEEAQWVNYDEDELCVKMQLADGIFETLIK 3076 *************************************97 PP
Or compare E9Q309 to CDD or PaperBLAST