A0A3Q7F690 has 308 amino acids
Query: DUF4408 [M=33]
Accession: PF14364.10
Description: Domain of unknown function (DUF4408)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.6e-16 45.5 6.7 5.4e-16 44.5 6.7 1.6 1 A0A3Q7F690
Domain annotation for each sequence (and alignments):
>> A0A3Q7F690
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 44.5 6.7 5.4e-16 5.4e-16 1 32 [. 37 68 .. 37 68 .. 0.99
Alignments for each domain:
== domain 1 score: 44.5 bits; conditional E-value: 5.4e-16
DUF4408 1 PslwsslrswltPpyLFvvlNvIIitIaasSr 32
P +ws+l wl+PpyL+ v+N II++I+a+Sr
A0A3Q7F690 37 PAIWSVLIAWLKPPYLYFVINAIILIIFATSR 68
89*****************************9 PP
Or compare A0A3Q7F690 to CDD or PaperBLAST