NP_001143007.1 has 232 amino acids
Query: DUF4408 [M=33] Accession: PF14364.10 Description: Domain of unknown function (DUF4408) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.6e-12 31.0 2.6 1.2e-11 30.5 2.6 1.2 1 NP_001143007.1 Domain annotation for each sequence (and alignments): >> NP_001143007.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.5 2.6 1.2e-11 1.2e-11 1 31 [. 46 76 .. 46 77 .. 0.96 Alignments for each domain: == domain 1 score: 30.5 bits; conditional E-value: 1.2e-11 DUF4408 1 PslwsslrswltPpyLFvvlNvIIitIaasS 31 P++w+ +r +l PpyLFv +++II++I+ S NP_001143007.1 46 PRVWAAARLCLVPPYLFVTVHLIILVIWKLS 76 99**************************998 PP
Or compare NP_001143007.1 to CDD or PaperBLAST