NP_001143007.1 has 232 amino acids
Query: DUF4408 [M=33]
Accession: PF14364.10
Description: Domain of unknown function (DUF4408)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.6e-12 31.0 2.6 1.2e-11 30.5 2.6 1.2 1 NP_001143007.1
Domain annotation for each sequence (and alignments):
>> NP_001143007.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 30.5 2.6 1.2e-11 1.2e-11 1 31 [. 46 76 .. 46 77 .. 0.96
Alignments for each domain:
== domain 1 score: 30.5 bits; conditional E-value: 1.2e-11
DUF4408 1 PslwsslrswltPpyLFvvlNvIIitIaasS 31
P++w+ +r +l PpyLFv +++II++I+ S
NP_001143007.1 46 PRVWAAARLCLVPPYLFVTVHLIILVIWKLS 76
99**************************998 PP
Or compare NP_001143007.1 to CDD or PaperBLAST