VIMSS10079355 has 308 amino acids
Query: DUF4408 [M=33]
Accession: PF14364.10
Description: Domain of unknown function (DUF4408)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1e-14 40.4 6.4 2e-14 39.4 6.4 1.5 1 VIMSS10079355
Domain annotation for each sequence (and alignments):
>> VIMSS10079355
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 39.4 6.4 2e-14 2e-14 1 32 [. 35 66 .. 35 66 .. 0.95
Alignments for each domain:
== domain 1 score: 39.4 bits; conditional E-value: 2e-14
DUF4408 1 PslwsslrswltPpyLFvvlNvIIitIaasSr 32
P+++ss+++wl+PpyL+v++NvIIi+ +s r
VIMSS10079355 35 PIILSSFLTWLKPPYLYVITNVIIIVVGVSYR 66
99***********************9998876 PP
Or compare VIMSS10079355 to CDD or PaperBLAST