VIMSS10079355 has 308 amino acids
Query: DUF4408 [M=33] Accession: PF14364.10 Description: Domain of unknown function (DUF4408) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-14 40.4 6.4 2e-14 39.4 6.4 1.5 1 VIMSS10079355 Domain annotation for each sequence (and alignments): >> VIMSS10079355 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.4 6.4 2e-14 2e-14 1 32 [. 35 66 .. 35 66 .. 0.95 Alignments for each domain: == domain 1 score: 39.4 bits; conditional E-value: 2e-14 DUF4408 1 PslwsslrswltPpyLFvvlNvIIitIaasSr 32 P+++ss+++wl+PpyL+v++NvIIi+ +s r VIMSS10079355 35 PIILSSFLTWLKPPYLYVITNVIIIVVGVSYR 66 99***********************9998876 PP
Or compare VIMSS10079355 to CDD or PaperBLAST