VIMSS10084375 has 344 amino acids
Query: DUF4408 [M=33]
Accession: PF14364.10
Description: Domain of unknown function (DUF4408)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.4e-21 61.6 5.7 4.2e-21 60.8 5.7 1.4 1 VIMSS10084375
Domain annotation for each sequence (and alignments):
>> VIMSS10084375
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 60.8 5.7 4.2e-21 4.2e-21 1 33 [] 40 72 .. 40 72 .. 0.98
Alignments for each domain:
== domain 1 score: 60.8 bits; conditional E-value: 4.2e-21
DUF4408 1 PslwsslrswltPpyLFvvlNvIIitIaasSrl 33
P+lwssl+swl+PpyL+vv+N+IIitI+asS++
VIMSS10084375 40 PILWSSLLSWLKPPYLYVVTNGIIITIVASSKY 72
99*****************************97 PP
Or compare VIMSS10084375 to CDD or PaperBLAST