VIMSS10089566 has 309 amino acids
Query: DUF4408 [M=33]
Accession: PF14364.10
Description: Domain of unknown function (DUF4408)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.3e-16 46.5 5.0 2.2e-16 45.7 5.0 1.4 1 VIMSS10089566
Domain annotation for each sequence (and alignments):
>> VIMSS10089566
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 45.7 5.0 2.2e-16 2.2e-16 2 33 .] 40 71 .. 40 71 .. 0.95
Alignments for each domain:
== domain 1 score: 45.7 bits; conditional E-value: 2.2e-16
DUF4408 2 slwsslrswltPpyLFvvlNvIIitIaasSrl 33
s+++ ++sw+tP++LFv+lN++I+tIa+sS++
VIMSS10089566 40 SVLTAMYSWFTPTVLFVFLNLMIGTIAISSSF 71
68899*************************98 PP
Or compare VIMSS10089566 to CDD or PaperBLAST