VIMSS10109942 has 326 amino acids
Query: DUF4408 [M=33] Accession: PF14364.10 Description: Domain of unknown function (DUF4408) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-15 42.3 3.8 4.8e-15 41.4 3.8 1.5 1 VIMSS10109942 Domain annotation for each sequence (and alignments): >> VIMSS10109942 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 41.4 3.8 4.8e-15 4.8e-15 1 33 [] 44 76 .. 44 76 .. 0.98 Alignments for each domain: == domain 1 score: 41.4 bits; conditional E-value: 4.8e-15 DUF4408 1 PslwsslrswltPpyLFvvlNvIIitIaasSrl 33 P++++++ ++l+PpyL++v+N II++I+a+S+l VIMSS10109942 44 PIIYDNTVFLLKPPYLYLVINSIIVCIIATSKL 76 99*****************************98 PP
Or compare VIMSS10109942 to CDD or PaperBLAST