XP_013685062.2 has 375 amino acids
Query: DUF4408 [M=33]
Accession: PF14364.10
Description: Domain of unknown function (DUF4408)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.7e-16 45.4 1.0 5e-16 44.6 1.0 1.4 1 XP_013685062.2
Domain annotation for each sequence (and alignments):
>> XP_013685062.2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 44.6 1.0 5e-16 5e-16 3 32 .. 3 32 .. 2 32 .. 0.94
Alignments for each domain:
== domain 1 score: 44.6 bits; conditional E-value: 5e-16
DUF4408 3 lwsslrswltPpyLFvvlNvIIitIaasSr 32
l s ++swltP++LF++lN++I+tI+++Sr
XP_013685062.2 3 LVSTAASWLTPTTLFLLLNLMIGTIVITSR 32
568899***********************9 PP
Or compare XP_013685062.2 to CDD or PaperBLAST