XP_015634056.1 has 291 amino acids
Query: DUF4408 [M=33]
Accession: PF14364.10
Description: Domain of unknown function (DUF4408)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.7e-12 32.6 2.8 4.4e-12 31.9 2.8 1.3 1 XP_015634056.1
Domain annotation for each sequence (and alignments):
>> XP_015634056.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 31.9 2.8 4.4e-12 4.4e-12 1 31 [. 57 87 .. 57 87 .. 0.97
Alignments for each domain:
== domain 1 score: 31.9 bits; conditional E-value: 4.4e-12
DUF4408 1 PslwsslrswltPpyLFvvlNvIIitIaasS 31
P++w+ +r wl PpyLFv +++II++I+ S
XP_015634056.1 57 PRVWAAARVWLVPPYLFVTVHLIILVIWKLS 87
99**************************877 PP
Or compare XP_015634056.1 to CDD or PaperBLAST