XP_031403475.1 has 357 amino acids
Query: DUF4408 [M=33]
Accession: PF14364.10
Description: Domain of unknown function (DUF4408)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.3e-19 55.3 4.7 3.7e-19 54.6 4.7 1.4 1 XP_031403475.1
Domain annotation for each sequence (and alignments):
>> XP_031403475.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 54.6 4.7 3.7e-19 3.7e-19 1 33 [] 48 80 .. 48 80 .. 0.99
Alignments for each domain:
== domain 1 score: 54.6 bits; conditional E-value: 3.7e-19
DUF4408 1 PslwsslrswltPpyLFvvlNvIIitIaasSrl 33
Ps++++l+swl PpyL+++lN+II++I+asS++
XP_031403475.1 48 PSVYDFLLSWLRPPYLYLLLNFIIVSIVASSKF 80
9*******************************8 PP
Or compare XP_031403475.1 to CDD or PaperBLAST