NP_569999.1 has 491 amino acids
Query: DUF4460 [M=110]
Accession: PF14687.10
Description: Domain of unknown function (DUF4460)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.9e-33 99.7 0.0 1e-32 98.7 0.0 1.6 1 NP_569999.1
Domain annotation for each sequence (and alignments):
>> NP_569999.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 98.7 0.0 1e-32 1e-32 2 110 .] 16 122 .. 15 122 .. 0.97
Alignments for each domain:
== domain 1 score: 98.7 bits; conditional E-value: 1e-32
DUF4460 2 srrlskkelrnaLrkFYlavhPDlfgqyPkekkvNeeSLklLnsyleelkkeeeksikpekkkLtFyvreseseeeekeskfklvsiqldensrdvke 99
+rrl +++l++aLr+FY+a+++D +++ P+ek+vNeeSL+lL+s+le+l+ +++ s+ p + +L+Fy+++ s+e+ +++ ++lv++q+d+++ d+++
NP_569999.1 16 CRRLLSTDLVTALRPFYQAIRTDGLAHNPAEKRVNEESLRLLCSHLESLTGPSA-SCLPPDGHLEFYIPS-GSDESGSRVVSRLVRVQVDRSLLDPRA 111
7999************************************************76.9**************.999************************ PP
DUF4460 100 tildilkscsl 110
+i++il+sc+l
NP_569999.1 112 VICQILRSCKL 122
*********96 PP
Or compare NP_569999.1 to CDD or PaperBLAST