XP_016878418.1 has 611 amino acids
Query: DUF4472 [M=107] Accession: PF14739.10 Description: Domain of unknown function (DUF4472) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-24 72.7 3.1 4.8e-16 45.6 3.6 4.3 5 XP_016878418.1 Domain annotation for each sequence (and alignments): >> XP_016878418.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 45.6 3.6 4.8e-16 4.8e-16 3 37 .. 130 164 .. 128 170 .. 0.94 2 ! 33.0 0.0 4.1e-12 4.1e-12 36 106 .. 234 309 .. 232 310 .. 0.89 3 ? -0.7 0.1 0.12 0.12 63 86 .. 369 392 .. 365 408 .. 0.72 4 ? -1.0 0.1 0.15 0.15 64 94 .. 430 460 .. 419 463 .. 0.69 5 ? -0.1 0.9 0.079 0.079 45 74 .. 550 579 .. 534 584 .. 0.76 Alignments for each domain: == domain 1 score: 45.6 bits; conditional E-value: 4.8e-16 DUF4472 3 EekLqisKeLVdlqietnrlrEqieaekfelktel 37 E++LqisKeLVd+qi+t+ l Eq+eae+f+lk+e+ XP_016878418.1 130 EQQLQISKELVDIQITTHHLHEQHEAEIFQLKSEV 164 9********************************98 PP == domain 2 score: 33.0 bits; conditional E-value: 4.1e-12 DUF4472 36 elLnlenrvleleleeek.....aaeeiqelqerlkeleedkqeleeelvslkknyqalekeleaeeaknqelsle 106 ++L+le+rvlelel+++ a ++++++ ++++e +++++ ++s ++++q ++k+ +++e+ + +l+ + XP_016878418.1 234 QILRLESRVLELELRGDGtsqgcAVPVESDPRHPRAAAQELRHKAQVPGHSDDHRFQVQPKNTMNPENEQHRLGSG 309 69*************99833444445678999*****************************************976 PP == domain 3 score: -0.7 bits; conditional E-value: 0.12 DUF4472 63 erlkeleedkqeleeelvslkkny 86 +l+++e+++ +l+ +l+ lk +y XP_016878418.1 369 GQLRQAEAENARLQLQLKKLKDEY 392 567777777777777777777666 PP == domain 4 score: -1.0 bits; conditional E-value: 0.15 DUF4472 64 rlkeleedkqeleeelvslkknyqalekele 94 ++ + +q+l+ + s++k++ +l++ +e XP_016878418.1 430 IRAAHRSREQQLARAARSYHKRLVDLSRRHE 460 4455566677888888888888888777776 PP == domain 5 score: -0.1 bits; conditional E-value: 0.079 DUF4472 45 leleleeekaaeeiqelqerlkeleedkqe 74 ele e+++ + ++e+l el+e k+e XP_016878418.1 550 AELERERAQLLVRATMAEEQLSELQEYKHE 579 477777777777778888888888877776 PP
Or compare XP_016878418.1 to CDD or PaperBLAST