P0C5J1 has 330 amino acids
Query: FAM86 [M=94]
Accession: PF14904.10
Description: Family of unknown function
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.3e-49 150.3 0.2 9.9e-49 149.7 0.2 1.3 1 P0C5J1
Domain annotation for each sequence (and alignments):
>> P0C5J1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 149.7 0.2 9.9e-49 9.9e-49 2 93 .. 7 98 .. 6 99 .. 0.97
Alignments for each domain:
== domain 1 score: 149.7 bits; conditional E-value: 9.9e-49
FAM86 2 aeaeellkeferrFlamrrlesfPwqaleeeLkeskssellkeilkktvkHplckkfppsvkyrrlfLseLikkhEaakvepLdelYealae 93
a++e ll+ ferrFla+r+l+sfPwq+le +L++s++sell++il+ktv+Hp+c+k+ppsvky+++fLseLikkhEa+++epLd+lYe+lae
P0C5J1 7 AGTELLLQGFERRFLAVRTLRSFPWQSLEAKLRDSSDSELLRDILQKTVRHPVCVKHPPSVKYAWCFLSELIKKHEAVHTEPLDKLYEVLAE 98
568899*************************************************************************************9 PP
Or compare P0C5J1 to CDD or PaperBLAST