Q96AQ1 has 378 amino acids
Query: CCDC92 [M=57]
Accession: PF14916.10
Description: Coiled-coil domain of unknown function
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.2e-23 68.2 9.0 5e-23 67.1 9.0 1.6 1 Q96AQ1
Domain annotation for each sequence (and alignments):
>> Q96AQ1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 67.1 9.0 5e-23 5e-23 5 54 .. 51 100 .. 47 102 .. 0.93
Alignments for each domain:
== domain 1 score: 67.1 bits; conditional E-value: 5e-23
CCDC92 5 qsleksikFLqeqhaatLkgLHkEIerLqkrnkdLtfklvmkegesskkg 54
+leks++FLq+qh+++L +LH+EIe+L+++nkdL++kl+m++ ++k+g
Q96AQ1 51 LDLEKSLQFLQQQHSEMLAKLHEEIEHLKRENKDLHYKLIMNQTSQKKDG 100
689****************************************9998876 PP
Or compare Q96AQ1 to CDD or PaperBLAST