XP_016875406.1 has 71 amino acids
Query: DUF4516 [M=46]
Accession: PF14990.10
Description: Domain of unknown function (DUF4516)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.6e-27 79.3 0.5 9e-27 78.9 0.5 1.2 1 XP_016875406.1
Domain annotation for each sequence (and alignments):
>> XP_016875406.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 78.9 0.5 9e-27 9e-27 1 45 [. 1 45 [. 1 46 [. 0.98
Alignments for each domain:
== domain 1 score: 78.9 bits; conditional E-value: 9e-27
DUF4516 1 mPaGvswgqYlklvsasvlSMlaGAqvVHnyYKPdltipdiekke 45
mPaGv+++ Ylk+++as+l+M+aGA vVH+yY+Pdltip+i++k
XP_016875406.1 1 MPAGVPMSTYLKMFAASLLAMCAGAEVVHRYYRPDLTIPEIPPKR 45
9*****************************************986 PP
Or compare XP_016875406.1 to CDD or PaperBLAST