XP_015329669.1 has 63 amino acids
Query: DUF4521 [M=204]
Accession: PF15021.10
Description: Protein of unknown function (DUF4521)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.4e-28 84.4 1.9 6.1e-28 84.2 1.9 1.0 1 XP_015329669.1
Domain annotation for each sequence (and alignments):
>> XP_015329669.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 84.2 1.9 6.1e-28 6.1e-28 1 59 [. 1 59 [. 1 62 [. 0.98
Alignments for each domain:
== domain 1 score: 84.2 bits; conditional E-value: 6.1e-28
DUF4521 1 mesqeatpssqseessvLdLpsvcDirdyvlqrpsqeasseafssvealsiplssevdp 59
m++qe+tp+sq+ees++LdLps++Dirdyvlqrpsq+++seafss+ea+sip+ss+vdp
XP_015329669.1 1 MATQETTPGSQTEESNALDLPSAYDIRDYVLQRPSQQTNSEAFSSEEACSIPCSSDVDP 59
9*********************************************************8 PP
Or compare XP_015329669.1 to CDD or PaperBLAST