Q96GE9 has 116 amino acids
Query: DUF4536 [M=47]
Accession: PF15055.10
Description: Domain of unknown function (DUF4536)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1e-26 79.3 1.6 1.6e-26 78.7 1.6 1.3 1 Q96GE9
Domain annotation for each sequence (and alignments):
>> Q96GE9
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 78.7 1.6 1.6e-26 1.6e-26 2 47 .] 47 92 .. 46 92 .. 0.98
Alignments for each domain:
== domain 1 score: 78.7 bits; conditional E-value: 1.6e-26
DUF4536 2 ClsCRllSGsGLigaGaYvyvqArrrlkqggkptmgtiaqvavalg 47
C+sCR+lSG GL+gaG+Yvy++Ar+++k+g++p++ ti+q++++l+
Q96GE9 47 CWSCRVLSGLGLMGAGGYVYWVARKPMKMGYPPSPWTITQMVIGLS 92
*******************************************997 PP
Or compare Q96GE9 to CDD or PaperBLAST