NP_001138904.1 has 67 amino acids
Query: DUF4538 [M=57]
Accession: PF15061.10
Description: Domain of unknown function (DUF4538)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.9e-32 97.1 0.0 2.1e-32 97.0 0.0 1.0 1 NP_001138904.1
Domain annotation for each sequence (and alignments):
>> NP_001138904.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 97.0 0.0 2.1e-32 2.1e-32 1 57 [] 2 58 .. 2 58 .. 0.98
Alignments for each domain:
== domain 1 score: 97.0 bits; conditional E-value: 2.1e-32
DUF4538 1 lrglkyallvgGfVgliglAlYPIiiaPmlhpeeYkkiQkinragikqeeiqPggmk 57
+r+l++al++gGf++lig+A+YPI+++P+++ eeYkk+Q+inragi qe++qP+g+k
NP_001138904.1 2 SRNLRTALIFGGFISLIGAAFYPIYFRPLMRLEEYKKEQAINRAGIVQEDVQPPGLK 58
69*****************************************************97 PP
Or compare NP_001138904.1 to CDD or PaperBLAST