NP_001138905.1 has 69 amino acids
Query: DUF4538 [M=57]
Accession: PF15061.10
Description: Domain of unknown function (DUF4538)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.7e-31 94.1 0.1 1.9e-31 93.9 0.1 1.0 1 NP_001138905.1
Domain annotation for each sequence (and alignments):
>> NP_001138905.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 93.9 0.1 1.9e-31 1.9e-31 1 57 [] 4 60 .. 4 60 .. 0.98
Alignments for each domain:
== domain 1 score: 93.9 bits; conditional E-value: 1.9e-31
DUF4538 1 lrglkyallvgGfVgliglAlYPIiiaPmlhpeeYkkiQkinragikqeeiqPggmk 57
+r+l++al++gGf++++g+A+YPI+++P+++ eeY+k+Q++nragi qe++qP+g+k
NP_001138905.1 4 ARNLRTALIFGGFISMVGAAFYPIYFRPLMRLEEYQKEQAVNRAGIVQEDVQPPGLK 60
69*****************************************************97 PP
Or compare NP_001138905.1 to CDD or PaperBLAST