NP_001289553.1 has 68 amino acids
Query: DUF4538 [M=57]
Accession: PF15061.10
Description: Domain of unknown function (DUF4538)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.9e-30 88.6 0.0 1e-29 88.4 0.0 1.1 1 NP_001289553.1
Domain annotation for each sequence (and alignments):
>> NP_001289553.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 88.4 0.0 1e-29 1e-29 2 57 .] 3 58 .. 2 58 .. 0.97
Alignments for each domain:
== domain 1 score: 88.4 bits; conditional E-value: 1e-29
DUF4538 2 rglkyallvgGfVgliglAlYPIiiaPmlhpeeYkkiQkinragikqeeiqPggmk 57
+++++l++gGfV+++++A+YPI+++P++h+e+Yk+ Qk+nrag++q +iqP g+k
NP_001289553.1 3 SSKRITLIFGGFVAAVAAAFYPIFFHPLTHSEDYKQVQKVNRAGVNQADIQPVGVK 58
579**************************************************997 PP
Or compare NP_001289553.1 to CDD or PaperBLAST