XP_005096219.1 has 99 amino acids
Query: DUF4538 [M=57]
Accession: PF15061.10
Description: Domain of unknown function (DUF4538)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.4e-21 62.3 0.2 2.2e-21 61.7 0.2 1.3 1 XP_005096219.1
Domain annotation for each sequence (and alignments):
>> XP_005096219.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 61.7 0.2 2.2e-21 2.2e-21 2 57 .] 34 89 .. 33 89 .. 0.98
Alignments for each domain:
== domain 1 score: 61.7 bits; conditional E-value: 2.2e-21
DUF4538 2 rglkyallvgGfVgliglAlYPIiiaPmlhpeeYkkiQkinragikqeeiqPggmk 57
++lk+ ++g +Vg i +A+YPIiiaP+++p + Q++ r+gi++e+iqPggmk
XP_005096219.1 34 KNLKSLGVIGVVVGGILVATYPIIIAPYMDPRPWHEVQNVGRQGIDREKIQPGGMK 89
78999**************************************************8 PP
Or compare XP_005096219.1 to CDD or PaperBLAST