D6RIA3 has 1793 amino acids
Query: DUF4585 [M=73]
Accession: PF15232.10
Description: Domain of unknown function (DUF4585)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.4e-30 90.8 4.2 9.9e-30 88.8 4.2 2.2 1 D6RIA3
Domain annotation for each sequence (and alignments):
>> D6RIA3
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 88.8 4.2 9.9e-30 9.9e-30 2 72 .. 1605 1672 .. 1604 1673 .. 0.96
Alignments for each domain:
== domain 1 score: 88.8 bits; conditional E-value: 9.9e-30
DUF4585 2 aaatqrklLlDpesGryyvvdlPlqvktktlfDpetGqYVevllpsaesevseaapvelllsplalgPgay 72
+ +tqrk+LlD ++G+yy+vd+P+q+ t++lfDpetGqYV+v++ s+++ +ap+++++ plal+Pgay
D6RIA3 1605 PQQTQRKMLLDVTTGQYYLVDTPVQPMTRRLFDPETGQYVDVPMT---SQQQAVAPMSISVPPLALSPGAY 1672
579*****************************************9...59999****************99 PP
Or compare D6RIA3 to CDD or PaperBLAST