XP_006518380.1 has 1412 amino acids
Query: DUF4585 [M=73] Accession: PF15232.10 Description: Domain of unknown function (DUF4585) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.4e-31 92.6 4.7 1.9e-30 91.1 4.7 1.9 1 XP_006518380.1 Domain annotation for each sequence (and alignments): >> XP_006518380.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 91.1 4.7 1.9e-30 1.9e-30 1 73 [] 1251 1322 .. 1251 1322 .. 0.97 Alignments for each domain: == domain 1 score: 91.1 bits; conditional E-value: 1.9e-30 DUF4585 1 saaatqrklLlDpesGryyvvdlPlqvktktlfDpetGqYVevllpsaesevseaapvelllsplalgPgayp 73 +++atq k+L+Dp+sG+y+v+d+Plqvk+kt++DpetG+YV+v++ps+e+ +se+ ++l++p+ l+Pg++p XP_006518380.1 1251 PYPATQ-KVLQDPQSGQYFVFDVPLQVKIKTFYDPETGKYVKVSVPSSEEASSEPPLQDALAAPYLLYPGFRP 1322 689999.************************************************99*************986 PP
Or compare XP_006518380.1 to CDD or PaperBLAST