Q6AI39 has 1079 amino acids
Query: GLTSCR1 [M=102]
Accession: PF15249.10
Description: Conserved region of unknown function on GLTSCR protein
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.2e-37 113.9 1.9 5.2e-37 112.7 1.9 1.7 1 Q6AI39
Domain annotation for each sequence (and alignments):
>> Q6AI39
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 112.7 1.9 5.2e-37 5.2e-37 1 102 [] 711 811 .. 711 811 .. 0.98
Alignments for each domain:
== domain 1 score: 112.7 bits; conditional E-value: 5.2e-37
GLTSCR1 1 dqkavlnPdvktpFasleDAvkRLlPYHvfqepkedeedlekadeefekvatellkrfqkllnkyrrlllreskrespseeevmlerllleeeraeleelkr 102
dq + ++Pd k+ F+sl+DAv+RLl YHv+q+ ++eedl k+d+efe+vat+llkr+q++lnkyr lll++++r +ps+e+vm++r++++eera+l+++kr
Q6AI39 711 DQAHTVTPD-KSHFRSLSDAVQRLLSYHVCQGSMPTEEDLRKVDNEFETVATQLLKRTQAMLNKYRCLLLEDAMRINPSAEMVMIDRMFNQEERASLSRDKR 811
8999*****.99**************************************************************************************9986 PP
Or compare Q6AI39 to CDD or PaperBLAST