SwissProt::F8VPZ9 has 1578 amino acids
Query: GLTSCR1 [M=102]
Accession: PF15249.10
Description: Conserved region of unknown function on GLTSCR protein
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.7e-40 124.0 0.6 2.7e-40 123.3 0.6 1.3 1 SwissProt::F8VPZ9
Domain annotation for each sequence (and alignments):
>> SwissProt::F8VPZ9
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 123.3 0.6 2.7e-40 2.7e-40 2 101 .. 1102 1201 .. 1101 1202 .. 0.97
Alignments for each domain:
== domain 1 score: 123.3 bits; conditional E-value: 2.7e-40
GLTSCR1 2 qkavlnPdvktpFasleDAvkRLlPYHvfqepkedeedlekadeefekvatellkrfqkllnkyrrlllreskrespseeevmlerllle 91
q +vl+Pd+kt F s+eDA++RLlPYHv+q++ ++++d++k+deefe+v+t+llkr+q++lnkyr lll+es+r sps+e+vm++r++++
SwissProt::F8VPZ9 1102 QGSVLHPDYKTAFPSFEDALHRLLPYHVYQGALPSPNDYHKVDEEFETVSTQLLKRTQAMLNKYRLLLLEESRRVSPSAEMVMIDRMFIQ 1191
789*************************************************************************************** PP
GLTSCR1 92 eeraeleelk 101
ee+++l+ +k
SwissProt::F8VPZ9 1192 EEKTTLALDK 1201
*****99876 PP
Or compare SwissProt::F8VPZ9 to CDD or PaperBLAST