NP_001018611.1 has 137 amino acids
Query: DUF4605 [M=59]
Accession: PF15378.10
Description: Domain of unknown function (DUF4605)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.6e-28 84.6 6.7 2e-28 84.3 6.7 1.1 1 NP_001018611.1
Domain annotation for each sequence (and alignments):
>> NP_001018611.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 84.3 6.7 2e-28 2e-28 1 59 [] 78 136 .. 78 136 .. 0.98
Alignments for each domain:
== domain 1 score: 84.3 bits; conditional E-value: 2e-28
DUF4605 1 svfdelNkqLlslGfprwnvGekvvePvvlvlllllllflGlrGlllvgvlcfviqlsq 59
++f+elNk+L++lGf+++++Gek+vePvv+++++lll+flG+++l+lvg+lc++i+++q
NP_001018611.1 78 TLFGELNKCLRGLGFTQLYFGEKIVEPVVVLVFWLLLWFLGIQALGLVGTLCIIIIYIQ 136
68******************************************************997 PP
Or compare NP_001018611.1 to CDD or PaperBLAST