NP_001070429.1 has 138 amino acids
Query: DUF4605 [M=59]
Accession: PF15378.10
Description: Domain of unknown function (DUF4605)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.8e-28 82.6 7.7 8.6e-28 82.3 7.7 1.1 1 NP_001070429.1
Domain annotation for each sequence (and alignments):
>> NP_001070429.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 82.3 7.7 8.6e-28 8.6e-28 1 59 [] 79 137 .. 79 137 .. 0.98
Alignments for each domain:
== domain 1 score: 82.3 bits; conditional E-value: 8.6e-28
DUF4605 1 svfdelNkqLlslGfprwnvGekvvePvvlvlllllllflGlrGlllvgvlcfviqlsq 59
++f+elNk Ll++Gf+r+++Ge++vePv++++++++l+flGl++ +lv++lc+vi++ q
NP_001070429.1 79 TLFGELNKSLLNMGFTRMYFGEQIVEPVIVIFFWVMLWFLGLPAFGLVALLCLVIIYVQ 137
68******************************************************987 PP
Or compare NP_001070429.1 to CDD or PaperBLAST