NP_689613.2 has 132 amino acids
Query: DUF4605 [M=59]
Accession: PF15378.10
Description: Domain of unknown function (DUF4605)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.3e-29 88.1 7.7 1.6e-29 87.8 7.7 1.1 1 NP_689613.2
Domain annotation for each sequence (and alignments):
>> NP_689613.2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 87.8 7.7 1.6e-29 1.6e-29 1 59 [] 73 131 .. 73 131 .. 0.98
Alignments for each domain:
== domain 1 score: 87.8 bits; conditional E-value: 1.6e-29
DUF4605 1 svfdelNkqLlslGfprwnvGekvvePvvlvlllllllflGlrGlllvgvlcfviqlsq 59
++f+elNk+L+++Gf+r+++Ge++vePv++++++++l+flGl++l+lv+vlc+vi++ q
NP_689613.2 73 TLFGELNKNLINMGFTRMYFGERIVEPVIVIFFWVMLWFLGLQALGLVAVLCLVIIYVQ 131
68******************************************************987 PP
Or compare NP_689613.2 to CDD or PaperBLAST