XP_005269665.1 has 121 amino acids
Query: DUF4605 [M=59]
Accession: PF15378.10
Description: Domain of unknown function (DUF4605)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.3e-30 90.5 3.5 2.9e-30 90.2 3.5 1.1 1 XP_005269665.1
Domain annotation for each sequence (and alignments):
>> XP_005269665.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 90.2 3.5 2.9e-30 2.9e-30 1 59 [] 62 120 .. 62 120 .. 0.98
Alignments for each domain:
== domain 1 score: 90.2 bits; conditional E-value: 2.9e-30
DUF4605 1 svfdelNkqLlslGfprwnvGekvvePvvlvlllllllflGlrGlllvgvlcfviqlsq 59
s f++lN+qL+++Gfp+w++G++ vePv+++lll+ll++lG+rGlllvg++++v++lsq
XP_005269665.1 62 SPFNDLNRQLVNMGFPQWHLGNHAVEPVTSILLLFLLMMLGVRGLLLVGLVYLVSHLSQ 120
579*****************************************************998 PP
Or compare XP_005269665.1 to CDD or PaperBLAST