NP_694570.1 has 139 amino acids
Query: DUF4609 [M=68]
Accession: PF15382.10
Description: Domain of unknown function (DUF4609)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.5e-43 132.9 1.0 3.1e-43 131.9 1.0 1.5 1 NP_694570.1
Domain annotation for each sequence (and alignments):
>> NP_694570.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 131.9 1.0 3.1e-43 3.1e-43 1 67 [. 70 136 .. 70 137 .. 0.99
Alignments for each domain:
== domain 1 score: 131.9 bits; conditional E-value: 3.1e-43
DUF4609 1 ekpdvkqksskKkvviPqiiitraSnEtlisysstgseEqrtirEqadwGpysRHRnPStvdAynlq 67
ekpdvkqkss+Kkvv+PqiiitraSnEtl+s+ss+gs+ qrtirE dwGpy RHRnPSt+dAyn++
NP_694570.1 70 EKPDVKQKSSRKKVVVPQIIITRASNETLVSCSSSGSDQQRTIREPEDWGPYRRHRNPSTADAYNSH 136
8****************************************************************97 PP
Or compare NP_694570.1 to CDD or PaperBLAST