SwissProt::Q9DDD5 has 793 amino acids
Query: DUF4704 [M=486]
Accession: PF15787.9
Description: Neurobeachin/BDCP, DUF4704 alpha solenoid region
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.5e-17 48.0 0.1 8.5e-17 47.1 0.1 1.5 1 SwissProt::Q9DDD5
Domain annotation for each sequence (and alignments):
>> SwissProt::Q9DDD5
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 47.1 0.1 8.5e-17 8.5e-17 445 486 .] 4 44 .. 1 44 [. 0.90
Alignments for each domain:
== domain 1 score: 47.1 bits; conditional E-value: 8.5e-17
DUF4704 445 eeeeseikelvielfkvLlvhalktekgGwrvlvdtlailhs 486
+ee ++i+e+v+++f++Ll+ha+k+e+gGwrv+vdtl+i+hs
SwissProt::Q9DDD5 4 SEE-QKITEMVYNIFRILLYHAIKYEWGGWRVWVDTLSIAHS 44
344.9**********************************996 PP
Or compare SwissProt::Q9DDD5 to CDD or PaperBLAST