E9Q3F7 has 1005 amino acids
Query: DUF4939 [M=112]
Accession: PF16297.9
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.1e-18 51.6 0.0 1e-17 50.3 0.0 1.6 1 E9Q3F7
Domain annotation for each sequence (and alignments):
>> E9Q3F7
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 50.3 0.0 1e-17 1e-17 27 103 .. 137 213 .. 130 220 .. 0.96
Alignments for each domain:
== domain 1 score: 50.3 bits; conditional E-value: 1e-17
DUF4939 27 fpelfdGeserlpefivqtlsymlvdektfssdalkvaflitrlkGralewvmpyiqkdspllnnyraflnemkeef 103
pe+fdG+ + l f+ q +m + fs d+++v f+ ++l Gra +w+ +q+ ++l+ ny af+ e+k++f
E9Q3F7 137 LPEKFDGNPDMLGPFMYQCQLFMEKSTRDFSVDRIRVCFVTSMLIGRAARWATAKLQRCTYLMHNYTAFMMELKHVF 213
69*************************************************************************99 PP
Or compare E9Q3F7 to CDD or PaperBLAST